PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02842.1.p
Common NameEUGRSUZ_F02842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 207aa    MW: 23422.8 Da    PI: 10.3338
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02842.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-18956148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd ll+++v+++G g+W+ ++ + g++R++k+c++rw++yl
  Eucgr.F02842.1.p  9 KGAWTEEEDVLLKKCVEKYGEGNWHQVPCRAGLNRCRKSCRLRWLNYL 56
                      79********************************************97 PP

2Myb_DNA-binding46.68.1e-1562106147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++ ++E + +++++k+lG++ W++Ia +++ gRt++++k++w+++
  Eucgr.F02842.1.p  62 RGAFQEDEVDMIIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 106
                       8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.943460IPR017930Myb domain
SuperFamilySSF466891.17E-296103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-22759IPR009057Homeodomain-like
SMARTSM007176.2E-15858IPR001005SANT/Myb domain
PfamPF002491.0E-16956IPR001005SANT/Myb domain
CDDcd001671.60E-101156No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2360111IPR009057Homeodomain-like
PROSITE profilePS5129419.21961111IPR017930Myb domain
SMARTSM007171.5E-1361109IPR001005SANT/Myb domain
PfamPF002491.5E-1362106IPR001005SANT/Myb domain
CDDcd001673.93E-967107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MKGAIGVRKG AWTEEEDVLL KKCVEKYGEG NWHQVPCRAG LNRCRKSCRL RWLNYLKPNI  60
KRGAFQEDEV DMIIRLHKLL GNRWSLIAGR LPGRTANDVK NYWNTHVAKK VDHHKSKEDN  120
HPGKCATKVS VIRPRPWTFT KSSAWLKGKA TLVASRAPPG SGSEGWPDAN SWPWESAMEE  180
RQKGWNELSF DANIWELLGV SPPAIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2431121109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02842.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062250.11e-143PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV92e-66MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059BTP41e-151A0A059BTP4_EUCGR; Uncharacterized protein
STRINGVIT_14s0006g01290.t011e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-67myb domain protein 113